DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and AT5G61050

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_200913.1 Gene:AT5G61050 / 836226 AraportID:AT5G61050 Length:252 Species:Arabidopsis thaliana


Alignment Length:131 Identity:31/131 - (23%)
Similarity:49/131 - (37%) Gaps:31/131 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PTALIYDESMSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKD-EILRLHTEE 168
            |...:.|::   |.||:         |.|  ||:..:|...|..|.:.|.....| ..|||..:|
plant   117 PLTNLNDQT---HMCLY---------RIT--LEQFNDLLFQENELNVDSDYPFFDLAALRLAEKE 167

  Fly   169 HFERLKETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRP 233
            ....|:..|           .|.|.::........:.:|....|:.:|:     |.::|...|||
plant   168 GSISLQTAS-----------DSLYGNVVCLGKEGVIPILTLTCTLSVVE-----KFKSGEIPIRP 216

  Fly   234 P 234
            |
plant   217 P 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526 28/117 (24%)
HDAC6-dom2 538..895 CDD:212527
zf-UBP 1007..1069 CDD:280334
AT5G61050NP_200913.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484694at2759
OrthoFinder 1 1.000 - - FOG0001161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.