DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and hda17

DIOPT Version :10

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_190035.1 Gene:hda17 / 823574 AraportID:AT3G44490 Length:158 Species:Arabidopsis thaliana


Alignment Length:90 Identity:23/90 - (25%)
Similarity:34/90 - (37%) Gaps:19/90 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 HYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELS 189
            |.||       ::..::.||.  .|.......||:.:.|..|       .||..:.|.|...|:|
plant    10 HAEC-------VKFVKKFNLP--LLVTGGGGYTKENVARCWT-------VETGILLDTELPNEIS 58

  Fly   190 SRYDSIYIHPSTFELSLLASGSTIE 214
               ::.||.....:.||...|..||
plant    59 ---ENDYIKYFAPDFSLKIPGGHIE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526 23/90 (26%)
HDAC6-dom2 538..895 CDD:212527
zf-UBP 1007..1069 CDD:460464
hda17NP_190035.1 Arginase_HDAC <3..116 CDD:450134 23/90 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.