DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and Hdac8

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:XP_006528338.1 Gene:Hdac8 / 70315 MGIID:1917565 Length:386 Species:Mus musculus


Alignment Length:325 Identity:97/325 - (29%)
Similarity:158/325 - (48%) Gaps:26/325 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 YAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNT 600
            |.|..:.:..|:    ...:.|.|...:|.:.:.|.|.|||:.:.|:.|:.:|:...||.|::..
Mouse    18 YIYSPEYVSICD----SLVKVPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQH 78

  Fly   601 VRRLLGREPKELHDAAGIYNSVYLHPRT---FDCATLAAGLVLQAVDSVLRGESRSGICNVRPPG 662
            ::: :.:|..|.|..:..|...|..|.|   ||.|....|..:.|...::.|:.:..| |.....
Mouse    79 LQK-VSQEGDEDHPDSIEYGLGYDCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAI-NWSGGW 141

  Fly   663 HHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYE 727
            |||::|...|||..|:..:......|.|  :|:|.||.|:|||:|.:..|....||:.:|||::.
Mouse   142 HHAKKDEASGFCYLNDAVLGILRLRRKF--DRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFS 204

  Fly   728 HGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAG 792
            .| |||  ..|:...||.|.||.::||:| .:.|:.|.:|....:.::..:...|||:.|::..|
Mouse   205 PG-FFP--GTGDMSDVGLGKGRYYSVNVP-IQDGIQDEKYYHICESVLKEVYQAFNPKAVVLQLG 265

  Fly   793 FDAAIGDPLGGCKVTAEGYG----MLTHW-LSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLG 852
            .|...|||:....:|..|.|    .:..| |:.|..|      .||||:.:.:...|..|..:||
Mouse   266 ADTIAGDPMCSFNMTPVGIGKCLKYVLQWQLATLILG------GGGYNLANTARCWTYLTGVILG 324

  Fly   853  852
            Mouse   325  324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527 96/323 (30%)
zf-UBP 1007..1069 CDD:280334
Hdac8XP_006528338.1 HDAC8 16..370 CDD:212524 97/325 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.