powered by:
Protein Alignment HDAC6 and usp49
DIOPT Version :9
Sequence 1: | NP_001259569.1 |
Gene: | HDAC6 / 32461 |
FlyBaseID: | FBgn0026428 |
Length: | 1179 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001038361.1 |
Gene: | usp49 / 559473 |
ZFINID: | ZDB-GENE-050208-484 |
Length: | 649 |
Species: | Danio rerio |
Alignment Length: | 58 |
Identity: | 29/58 - (50%) |
Similarity: | 35/58 - (60%) |
Gaps: | 0/58 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1007 CSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYV 1064
|..|.:|...|.||.|.|||||||:..|...|..:.||||||...:|.|:|:||..||
Zfish 26 CVDCDTTESVWACLKCTHVACGRYMEEHSRSHYQQTQHPLAMDVRELDVFCFACGDYV 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1867 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.