DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and Usp27x

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_062334.2 Gene:Usp27x / 54651 MGIID:1859645 Length:438 Species:Mus musculus


Alignment Length:146 Identity:32/146 - (21%)
Similarity:45/146 - (30%) Gaps:48/146 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 DRYPTRDTAIPLPPEKLTSNAARLQV-------LRAETKLSVPSFKVCYAYDAQMLLHCN----- 547
            ::|||.:|..| ..|.|..|..|.::       ||....|....|..|.   .|.|.|..     
Mouse    45 EKYPTWETTKP-ELELLGHNPRRRRIASSFTIGLRGLINLGNTCFMNCI---VQALTHTPILRDF 105

  Fly   548 -LNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKE 611
             |:|....|.||                            .|:||....:  :..|.|....|..
Mouse   106 FLSDRHRCEMPS----------------------------PELCLVCEMS--SLFRELYSGNPSP 140

  Fly   612 LHDAAGIYNSVYLHPR 627
             |....:.:.|::|.|
Mouse   141 -HVPYKLLHLVWIHAR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527 18/96 (19%)
zf-UBP 1007..1069 CDD:280334
Usp27xNP_062334.2 UCH 77..418 CDD:278850 23/113 (20%)
Peptidase_C19D 78..419 CDD:239125 22/112 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.