DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and usp3

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:XP_012821863.1 Gene:usp3 / 448475 XenbaseID:XB-GENE-962759 Length:522 Species:Xenopus tropicalis


Alignment Length:102 Identity:36/102 - (35%)
Similarity:45/102 - (44%) Gaps:23/102 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   986 CPHLR---LLRPEEA--PRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHP 1045
            ||||.   .:.|:.|  |....|...||||.|....||||:|..|.||||||.|.::|..:.|.|
 Frog     3 CPHLTTSVCIVPDAAVFPNGCPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQAP 67

  Fly  1046 L------------------AMSTADLSVWCYACSAYV 1064
            |                  .|..:..|.:||.|..:|
 Frog    68 LNCHKRQEKTDKDRMQHTVCMDCSSYSTYCYRCDDFV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527
zf-UBP 1007..1069 CDD:280334 28/76 (37%)
usp3XP_012821863.1 zf-UBP 29..107 CDD:366940 28/76 (37%)
UCH 161..510 CDD:366104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.