DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and hdac2

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_001005432.1 Gene:hdac2 / 447995 XenbaseID:XB-GENE-485807 Length:488 Species:Xenopus tropicalis


Alignment Length:474 Identity:117/474 - (24%)
Similarity:197/474 - (41%) Gaps:57/474 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   533 KVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAH 597
            ||||.||..:..:  ....|||.:|.||:..|.:..:|||.::|:...|..||.:|:...|:..:
 Frog    11 KVCYYYDGDIGNY--YYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEY 73

  Fly   598 VNTVRRLLGREPKELHDAAGIYNSVYLHPRTFD-----CATLAAGLVLQAVDSVLRGESRSGICN 657
            :..:|.:......|.......:|.....| .||     |.....|.|..||.  |..:......|
 Frog    74 IKFLRSIRPDNMSEYSKQMQRFNVGEDCP-VFDGLFEFCQLSTGGSVAGAVK--LNRQQTDMAVN 135

  Fly   658 VRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYIS 722
            .....|||::....|||..|::.:|....::..  :|||.:|.|:|||:|.:..|.:..:|:.:|
 Frog   136 WAGGLHHAKKSEASGFCYVNDIVLAILELLKYH--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVS 198

  Fly   723 LHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLV 787
            .|:|  |.:||  ..|:...:|.|.|:.:.||.|. :.|:.|..|...|:.:|..:...:.|..|
 Frog   199 FHKY--GEYFP--GTGDLRDIGAGKGKYYAVNFPM-RDGIDDESYGQIFKPIISKVMEMYQPSAV 258

  Fly   788 LVSAGFDAAIGDPLGGCKVTAEGYG-----MLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCT 847
            ::..|.|:..||.||...:|.:|:.     :.|..|..|..|      .|||.:.:::...|..|
 Frog   259 VLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG------GGGYTIRNVARCWTYET 317

  Fly   848 KTLLGDPVPT------------PQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVG-- 898
            ...|...:|.            |......  .|..:..|:..|.:::..|....:.|.|....  
 Frog   318 AVALDCEIPNELPYNDYFEYFGPDFKLHI--SPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGV 380

  Fly   899 --RRLPRDPV---VGENNNED-----FLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSK 953
              :.:|.|.|   .|:...||     .:.||.:.:....:.:.:...| .|.|.:..|.:....|
 Frog   381 QMQAIPEDAVQEDSGDEEGEDPDKRISIRASDKRIACDEEFSDSEDEG-EGGRRNVADHKKGAKK 444

  Fly   954 PKV--KVKTLSDYLAENKE 970
            .::  :.|...|..::.||
 Frog   445 ARLEEEKKETDDKKSDVKE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527 95/378 (25%)
zf-UBP 1007..1069 CDD:280334
hdac2NP_001005432.1 HDAC2 9..374 CDD:212535 99/382 (26%)
CobT <386..>486 CDD:330670 17/79 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.