DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and USP27X

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_001138545.1 Gene:USP27X / 389856 HGNCID:13486 Length:438 Species:Homo sapiens


Alignment Length:338 Identity:61/338 - (18%)
Similarity:92/338 - (27%) Gaps:161/338 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   846 CTKTLLGDPVPT-----PQL------------------GATALQKPPTVAFQSCV---------- 877
            |:...||:..||     |:|                  |...|.......|.:|:          
Human    38 CSVPGLGEKFPTWETTKPELELLGHNPRRRRITSSFTIGLRGLINLGNTCFMNCIVQALTHTPIL 102

  Fly   878 -------------ESLQQCLQVQRNH-WRSLEFVGRRLPRDP-------------VVG--ENNNE 913
                         .|.:.||..:.:. :|.| :.|...|..|             :.|  :.:..
Human   103 RDFFLSDRHRCEMPSPELCLVCEMSSLFREL-YSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAH 166

  Fly   914 DFLTASL--RHLNISNDDATAAA---------------GGLAGD------------RPDCGD--- 946
            :||.|:|  .|.:...||...||               |||..|            ...|.|   
Human   167 EFLIAALDVLHRHCKGDDVGKAANNPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISL 231

  Fly   947 ERPS----------GSKPKVK-------VKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRP 994
            :.|.          |.:..|.       :.||:|.|.                       |..||
Human   232 DLPGSCTSFWPMSPGRESSVNGESHIPGITTLTDCLR-----------------------RFTRP 273

  Fly   995 EEAPRSLDSGA--ECSVCGSTGENWVCLSCRH---VACGRYVNAHMEQHSVEEQHPLAMSTADLS 1054
            |.    |.|.|  :|..|.|..|:...|:...   |||..:...   :||.:::..:        
Human   274 EH----LGSSAKIKCGSCQSYQESTKQLTMNKLPVVACFHFKRF---EHSAKQRRKI-------- 323

  Fly  1055 VWCYACSAYVDHP 1067
                  :.|:..|
Human   324 ------TTYISFP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527 15/95 (16%)
zf-UBP 1007..1069 CDD:280334 12/64 (19%)
USP27XNP_001138545.1 Peptidase_C19D 78..419 CDD:239125 53/298 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.