DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and Usp44

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_001193780.1 Gene:Usp44 / 327799 MGIID:3045318 Length:711 Species:Mus musculus


Alignment Length:104 Identity:36/104 - (34%)
Similarity:51/104 - (49%) Gaps:8/104 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   986 CPHLRLLRPEEAPRSLDSGA-ECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMS 1049
            |.|:..|:..:....||... .|.||.:|...|.||||.|||||:|:..|..:|..|..||:|..
Mouse     4 CKHVEQLQLAQGHSILDPQKWYCMVCNTTESIWACLSCSHVACGKYIQEHALKHFQESSHPVAFE 68

  Fly  1050 TADLSVWCYACSAYV-------DHPRLYAYLNPLHEDKF 1081
            ..|:..:||.|:.||       |...|.:.|:.:...|:
Mouse    69 VNDMYAFCYLCNDYVLNDNAAGDLKSLRSTLSTIKSKKY 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527
zf-UBP 1007..1069 CDD:280334 28/68 (41%)
Usp44NP_001193780.1 zf-UBP 26..88 CDD:366940 27/61 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..251
UCH 272..674 CDD:366104
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..711
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.