DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and HDAC11

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster


Alignment Length:306 Identity:80/306 - (26%)
Similarity:132/306 - (43%) Gaps:49/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 CRELNLTERCLELPSRSATKDEILRLHTEEHFERLK---ETSGIRDDERMEELSSRY-DSIYIHP 199
            |.:|.|.:.....|: ..|||::.|:||.|:.:.|:   ..:.|.:...|..:.:|| ...|:.|
  Fly    66 CAQLQLDDGSFYEPT-ELTKDQLRRIHTREYLKSLRWSMNVACIAEVPLMAFVPNRYIQRSYLRP 129

  Fly   200 STFELSLLASGSTIELVDHLVAGK--AQNGMAIIRPPG-HHAMKAEYNGYCFFNNVALATQHALD 261
            ..|:    |:||       ::|||  ...|.||....| ||.......|:|.:.:::|......:
  Fly   130 MRFQ----AAGS-------ILAGKLALDYGWAINLGGGFHHCCSYRGGGFCPYADISLLIVRLFE 183

  Fly   262 VH--KLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGY 324
            ..  :::||:|:|.|.|.|.|.:|.|.|...|..|.::   :...:|..|.         |....
  Fly   184 QEPFRVRRIMIVDLDAHQGNGHERDFNNVAAVYIFDMY---NAFVYPRDHV---------AKESI 236

  Fly   325 NFNVPL-NATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEGEMEVTPACY---P 385
            ...|.| |.|  .:|.||...::.|:....||:|::::.:||.|...|.|.|.:.::....   .
  Fly   237 RCAVELRNYT--EDGFYLRQLKRCLMQSLAEFRPDMVVYNAGTDVLEGDPLGNLAISAEGVIERD 299

  Fly   386 HLLNPLLRLADARVAVVLEGGY-------CLDSLAEGAALTLRSLL 424
            .|:....|.....|.::|.|||       ..||:..   |.|:.||
  Fly   300 RLVFSTFRALGIPVVMLLSGGYLKASAGVITDSIVN---LRLQGLL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526 80/306 (26%)
HDAC6-dom2 538..895 CDD:212527
zf-UBP 1007..1069 CDD:280334
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 76/298 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458016
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.