DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and Usp30

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_001100623.1 Gene:Usp30 / 304579 RGDID:1307949 Length:517 Species:Rattus norvegicus


Alignment Length:310 Identity:59/310 - (19%)
Similarity:98/310 - (31%) Gaps:121/310 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 GGYC-LDSLAEGAALTLRSLLGDPCPPLVE-----TVPLPRAELAQALLSCIAVHRPHWRCLQLQ 463
            |..| ::||.:|.:         .||..|:     |....|.:.......|:::     ..|.|.
  Rat    74 GNTCFMNSLLQGLS---------ACPAFVKWLEEFTTQYSRDQQGPHTHQCLSL-----TLLSLL 124

  Fly   464 QTYDCVELQDRDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLS 528
            :...|.|:.:                                   |::...:..|.|||. .:..
  Rat   125 KALSCQEVTE-----------------------------------EEVLDASCLLDVLRM-YRWQ 153

  Fly   529 VPSFKVCYAYDAQMLLH---CNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVC 590
            :.||:   ..||..|.|   .:|.|. ...|| |:.|:..:|.    |:|..:::||..|     
  Rat   154 ISSFE---EQDAHELFHVITSSLEDE-RDRQP-RVTHLFDVHS----LEQQSEMAPRQVT----- 204

  Fly   591 LAHTRAHVNTVRRLLGREPKELHDAAGIYNSVY-LHPRTFDCATLAAGLVLQAVDSVLRGESRSG 654
             .|||.           .|   |.....:.|.: .|.|.                      |.:.
  Rat   205 -CHTRG-----------SP---HPTTNPWKSQHPFHGRL----------------------SSNM 232

  Fly   655 ICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHH 704
            :|.      |.|...|..|..|::::::...|  .:|  ..|.:|..:||
  Rat   233 VCK------HCEHQSPVRFDTFDSLSLSIPAA--TWG--HPLTLDHCLHH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526 11/57 (19%)
HDAC6-dom2 538..895 CDD:212527 37/171 (22%)
zf-UBP 1007..1069 CDD:280334
Usp30NP_001100623.1 Peptidase_C19F 69..500 CDD:239127 59/310 (19%)
UBP12 <69..>265 CDD:227847 55/301 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.