DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and Hdac1

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_001020580.1 Gene:Hdac1 / 297893 RGDID:1309799 Length:482 Species:Rattus norvegicus


Alignment Length:468 Identity:115/468 - (24%)
Similarity:200/468 - (42%) Gaps:40/468 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   533 KVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAH 597
            ||||.||..:..:  ....|||.:|.||:..|.:..:|||.::|:...|..|..:|:...|:..:
  Rat    10 KVCYYYDGDVGNY--YYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDY 72

  Fly   598 VNTVRRLLGREPKELHDAAGIYNSVYLHPRTFD-----CATLAAGLVLQAVDSVLRGESRSGICN 657
            :..:|.:......|.......:|.....| .||     |.....|.|..||.  |..:......|
  Rat    73 IKFLRSIRPDNMSEYSKQMQRFNVGEDCP-VFDGLFEFCQLSTGGSVASAVK--LNKQQTDIAVN 134

  Fly   658 VRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYIS 722
            .....|||::....|||..|::.:|....::..  :|||.:|.|:|||:|.:..|.:..:|:.:|
  Rat   135 WAGGLHHAKKSEASGFCYVNDIVLAILELLKYH--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVS 197

  Fly   723 LHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLV 787
            .|:|  |.:||  ..|:...:|.|.|:.:.||.|. :.|:.|..|...|:.::..:...|.|..|
  Rat   198 FHKY--GEYFP--GTGDLRDIGAGKGKYYAVNYPL-RDGIDDESYEAIFKPVMSKVMEMFQPSAV 257

  Fly   788 LVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLG 852
            ::..|.|:..||.||...:|.:|:.....::.:. :..:::...|||.:.:::...|..|...|.
  Rat   258 VLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSF-NLPMLMLGGGGYTIRNVARCWTYETAVALD 321

  Fly   853 DPVPT------------PQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVG----RRL 901
            ..:|.            |......  .|..:..|:..|.|::..|....:.|.|....    :.:
  Rat   322 TEIPNELPYNDYFEYFGPDFKLHI--SPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAI 384

  Fly   902 PRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGD---ERPSGSKPKVKVKTLSD 963
            |.|.:..|:.:||......| ::|.:.|...|......|..:.|:   :..|..|...:|||..:
  Rat   385 PEDAIPEESGDEDEEDPDKR-ISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDE 448

  Fly   964 YLAENKEALEQSE 976
            ...:.:|..|.:|
  Rat   449 KEKDPEEKKEVTE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527 91/373 (24%)
zf-UBP 1007..1069 CDD:280334
Hdac1NP_001020580.1 HDAC1 4..374 CDD:212534 95/378 (25%)
Histone deacetylase 9..321 86/323 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..482 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.