DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and Hdac11

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_001100080.2 Gene:Hdac11 / 297453 RGDID:1311706 Length:347 Species:Rattus norvegicus


Alignment Length:269 Identity:71/269 - (26%)
Similarity:113/269 - (42%) Gaps:43/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   563 IHKMHD-DYG-------LLKQMKQLS------PRAATTDEVCLAHTRAHVNTVR-----RLLGRE 608
            :.|:|. |.|       .||:.|.||      .|.|:.:::.:.|||.::|.::     ..:...
  Rat    31 LEKLHPFDAGKWGKVINFLKEEKLLSDGMLVEAREASEEDLLVVHTRRYLNELKWSFVVATITEI 95

  Fly   609 PKELHDAAGIYNSVYLHP-RTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHG 672
            |..:.....:.....|.| ||....|:.||.:  ||:       |....||....||...|...|
  Rat    96 PPVIFLPNFLVQRKVLRPLRTQTGGTIMAGKL--AVE-------RGWAINVGGGFHHCSSDRGGG 151

  Fly   673 FCIFNNVAIAAQYAI-RDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGP 736
            ||.:.::.:|.::.. |..|:.|..|:|.|.|.|||.:..|..:.:|..:.::. .|  .:|.  
  Rat   152 FCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMGDKRVYIMDVYN-RH--IYPG-- 211

  Fly   737 DGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPL 801
                |...|.|.|. .|.:.|   |..|.||....::.:.....|..|.:|:.:||.|...||.|
  Rat   212 ----DRFAKEAIRR-KVELEW---GTEDEEYLEKVERNVRRSLQEHLPDVVVYNAGTDVLEGDRL 268

  Fly   802 GGCKVTAEG 810
            ||..::..|
  Rat   269 GGLSISPAG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527 71/269 (26%)
zf-UBP 1007..1069 CDD:280334
Hdac11NP_001100080.2 HDAC_classIV 35..319 CDD:212519 70/265 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.