DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and Usp3

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:XP_006511173.1 Gene:Usp3 / 235441 MGIID:2152450 Length:606 Species:Mus musculus


Alignment Length:221 Identity:57/221 - (25%)
Similarity:73/221 - (33%) Gaps:73/221 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   861 GATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNI 925
            |...|..|.....||.....|.||..:|.....|.|:|  .|:.|                    
Mouse    24 GGVGLAVPRGPDRQSAALRAQLCLDCRRASPFGLRFLG--FPQAP-------------------- 66

  Fly   926 SNDDATAAAGGLAGDRPDCGDERPSGSKPKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLR 990
                    |...|.:|...|......|...|:||      .||:                   ||
Mouse    67 --------ASPAAPERTALGAAHLGVSLQPVRVK------FENR-------------------LR 98

  Fly   991 LLR-PEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQH---------------- 1038
            ..: ||:|..|...|| ..||.|....||||:|..|.||||||.|.::|                
Mouse    99 APKAPEKAANSCFGGA-ARVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQIPLLNHKRSEK 162

  Fly  1039 SVEEQHPLAMSTADLSVWCYACSAYV 1064
            ..:.||.:.|..:..|.:||.|..:|
Mouse   163 QEKAQHTVCMDCSSYSTYCYRCDDFV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527 9/33 (27%)
zf-UBP 1007..1069 CDD:280334 25/74 (34%)
Usp3XP_006511173.1 zf-UBP 117..191 CDD:366940 25/72 (35%)
UCH 245..594 CDD:366104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.