DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HDAC6 and Usp22

DIOPT Version :9

Sequence 1:	NP_001259569.1	Gene:	HDAC6 / 32461	FlyBaseID:	FBgn0026428	Length:	1179	Species:	Drosophila melanogaster
Sequence 2:	NP_001004143.2	Gene:	Usp22 / 216825	MGIID:	2144157	Length:	525	Species:	Mus musculus

Alignment Length:	131	Identity:	27/131 - (20%)
Similarity:	51/131 - (38%)	Gaps:	32/131 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   952 SKPKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGSTGE- 1015
            ::|:.:|:.:...||              .|...|.||...:.:...::|.:..:|.|...|.|
Mouse     3 ARPEPEVEAMDAELA--------------VPPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEA 53

  Fly  1016 ------NWVCLSC-----RHVAC------GRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAY 1063
                  :.||..|     |..:|      |.:...|:..|:..::|.||:......::|:.|..|
Mouse    54 RKRKAKSCVCHVCGIHLNRLHSCLYCVFFGCFTKKHIHDHAKSKRHNLAIDLMYGGIYCFLCQDY 118

  Fly  1064 V 1064
            :
Mouse   119 I 119

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HDAC6	NP_001259569.1	HDAC10_HDAC6-dom1	119..457	CDD:212526
		HDAC6-dom2	538..895	CDD:212527
		zf-UBP	1007..1069	CDD:280334	18/76 (24%)
Usp22	NP_001004143.2	zf-UBP	63..123	CDD:396634	13/57 (23%)
Usp22	NP_001004143.2	Peptidase_C19D	176..518	CDD:239125
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1867
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900