DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and usp-3

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_493434.3 Gene:usp-3 / 190579 WormBaseID:WBGene00013506 Length:550 Species:Caenorhabditis elegans


Alignment Length:137 Identity:30/137 - (21%)
Similarity:55/137 - (40%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   943 DCGDERPSGSKPKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAEC 1007
            ||.:..|.|             :...|:.:|.:.:|..   ......::::.:|..::.     |
 Worm    10 DCVERVPKG-------------MFRKKQDMEDNNLFLE---GNSNRGKVVKNQEIIKTF-----C 53

  Fly  1008 SVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVD---HPRL 1069
            ..|.:..::.:||:|..:.|||..:.|...|..|..||:.:......::||:|...|.   .|.|
 Worm    54 DECDNCNKSLMCLTCGRILCGRNDSGHALHHFEETSHPVVIDCISFELYCYSCDDEVSLDFEPSL 118

  Fly  1070 YAYLNPL 1076
            |..|..|
 Worm   119 YGVLKSL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527
zf-UBP 1007..1069 CDD:280334 18/64 (28%)
usp-3NP_493434.3 zf-UBP 53..111 CDD:366940 16/57 (28%)
UCH 229..542 CDD:366104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.