DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and C34F6.9

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_001366881.1 Gene:C34F6.9 / 181312 WormBaseID:WBGene00007943 Length:1181 Species:Caenorhabditis elegans


Alignment Length:230 Identity:46/230 - (20%)
Similarity:82/230 - (35%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAADP-RKSNKPNAALLE 67
            |.||.||.|.   ::.::..:...|.....:......|||...|..|:...| .|..:.:..:.:
 Worm   769 PAVTDRSEQD---KSPSLPREKNIGKDSGKSRLASQRSSSRRSSAPFSEESPSTKKTRFSTRVEQ 830

  Fly    68 AKRRARNNMLKN-------QGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQ--------H 117
            ..||..|..:|:       .....:..:.|.|.:.:..:::|.:.| |.|..||.|        :
 Worm   831 YSRRVSNETIKSLLQQVLTPKAADECDIQDHFPSPIVRRAIVNRNT-LCYAISMVQLLMRVPQVY 894

  Fly   118 CCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDD 182
            ..:  :.|....::..|  ..|....||....|.|....|...:..|.:        ....|.|:
 Worm   895 SIV--RSHSHKKQKANR--SECFLCMLTNLISERPRADDTPAFVALLKS--------NWKNIEDE 947

  Fly   183 ------ERMEELSSRYDSIYIHP-----STFELSL 206
                  |.|:...:::|..|:|.     |.||:.:
 Worm   948 GMQCVMEAMQYFFNKFDEEYMHAHPPIRSYFEIEM 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526 19/99 (19%)
HDAC6-dom2 538..895 CDD:212527
zf-UBP 1007..1069 CDD:280334
C34F6.9NP_001366881.1 Peptidase_C19 949..1130 CDD:239072 8/34 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.