DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and Hdac3

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_034541.2 Gene:Hdac3 / 15183 MGIID:1343091 Length:428 Species:Mus musculus


Alignment Length:333 Identity:86/333 - (25%)
Similarity:157/333 - (47%) Gaps:29/333 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 VCYAYDAQMLLHCNLN-DTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAH 597
            |.|.||..:   .|.: ..|||.:|.|:...|.:...|||.|:|....|..|:..::|..|:..:
Mouse     5 VAYFYDPDV---GNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDY 66

  Fly   598 VNTVRRLLGREPKELH------DAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGIC 656
            ::.::|:   .|..:.      :|..:.:...:.|..|:..:...|..||....:     .:.||
Mouse    67 IDFLQRV---SPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQL-----NNKIC 123

  Fly   657 NVR---PPG-HHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPK 717
            ::.   ..| |||::....|||..|::.|.....::..  .|||.:|.|:|||:|.|..|....:
Mouse   124 DIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYH--PRVLYIDIDIHHGDGVQEAFYLTDR 186

  Fly   718 VLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEF 782
            |:.:|.|:|  |::|..| .|:...||..:||.:.:|:|. :.|:.|..|...||.:|..:...:
Mouse   187 VMTVSFHKY--GNYFFPG-TGDMYEVGAESGRYYCLNVPL-RDGIDDQSYKHLFQPVISQVVDFY 247

  Fly   783 NPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCT 847
            .|..:::..|.|:...|.||...::..|:|....::.:. :..::|...|||.|.:::...|..|
Mouse   248 QPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSF-NIPLLVLGGGGYTVRNVARCWTYET 311

  Fly   848 KTLLGDPV 855
            ..|:.:.:
Mouse   312 SLLVEEAI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527 84/329 (26%)
zf-UBP 1007..1069 CDD:280334
Hdac3NP_034541.2 HDAC3 3..383 CDD:212529 86/333 (26%)
Histone deacetylase 3..316 86/328 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.