DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dah and CG42585

DIOPT Version :10

Sequence 1:NP_511162.1 Gene:dah / 32459 FlyBaseID:FBgn0015926 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001162977.1 Gene:CG42585 / 8674069 FlyBaseID:FBgn0260953 Length:349 Species:Drosophila melanogaster


Alignment Length:350 Identity:78/350 - (22%)
Similarity:120/350 - (34%) Gaps:85/350 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 HSNSCA-GCRKEHIVGIRFRCQVCRDISLCLPCFAVGFAGGRHEPGHRMCEVF--VEDQPPLRWT 340
            |.|.|. ||:.....|.||||..|.:.:||..|:........|...|.| ::|  .:|..||.:.
  Fly     3 HRNICCNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPM-QLFPDSDDLVPLLYG 66

  Fly   341 R-----HLARL-----CGWLVMPRKTQEEE---RRGFCNAQESGP-ALGQSAATPIPAETRSVRS 391
            .     ||:..     ||.|.:..|...|.   :....|.....| ..|.|||..:.....|...
  Fly    67 EIPELVHLSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLSAAELVAIRHLSKHL 131

  Fly   392 QCQEKDRTVVLQQQQQELCSLTGLASEASSRLQSIIDRLLLQNAKLETQLQTVATASSSEISQFL 456
            .....|....|:..              :..|:.|..|..:::.: ::||||...:...:||.:|
  Fly   132 LHNHIDHANYLEPD--------------TPPLRRIFTRNHMRHHR-QSQLQTTPNSRIFDISVWL 181

  Fly   457 SAHQCFLLQIIEDMRQLSHASAVTSPPPAPAAQVAPSAAPLVSS-------------TFLSSSTP 508
            |..     ::..|.:.||:     :.||..||.....|..|.|.             .:::....
  Fly   182 STG-----RVSSDPQLLSN-----NDPPEEAANSESLALGLSSGGPFEHDDDRYVLLQWIAQQKV 236

  Fly   509 Q----------RQMLF------------DMYAPVGANLTHSING-ADL---NRSYLEANKSDYSL 547
            |          |:.||            ::..|.|.......|| :||   |.|.|....|..||
  Fly   237 QCHDTDESQRLRRTLFVEHLLISMLCCEELQLPDGDRRIREGNGESDLDQENHSSLVKVMSVMSL 301

  Fly   548 NDISLWFDQRRSSVQPGQGPGSLPA 572
            ....:|   :.:.:...:|.|.:.|
  Fly   302 PWTGVW---QTNQLDGSEGEGEIRA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dahNP_511162.1 EFh_DAH 81..250 CDD:320003
EF-hand-like motif 81..120 CDD:320003
EF-hand-like motif 132..166 CDD:320003
EF-hand-like motif 173..210 CDD:320003
EF-hand-like motif 223..250 CDD:320003
ZZ_dah 281..329 CDD:239085 16/48 (33%)
CG42585NP_001162977.1 ZZ_PCMF_like 6..54 CDD:239078 15/48 (31%)
zf-Di19 76..130 CDD:428539 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.