DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dah and CG15286

DIOPT Version :9

Sequence 1:NP_511162.1 Gene:dah / 32459 FlyBaseID:FBgn0015926 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001285929.1 Gene:CG15286 / 34834 FlyBaseID:FBgn0028531 Length:511 Species:Drosophila melanogaster


Alignment Length:498 Identity:99/498 - (19%)
Similarity:164/498 - (32%) Gaps:149/498 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 KRIEDTEHLIHSNSCAGCRKEHIVGIRFRCQVCRDISLCLPCFAVGFAGGRHEPGHRMCEV---- 329
            :|||          |.||.|..:....:||..|:|..:|..|:...|....|...|.:..|    
  Fly     7 ERIE----------CKGCGKRSLTFRCYRCLSCQDFDICEECYDNDFTTSTHPFDHPVVCVLIPA 61

  Fly   330 ---------FVEDQPP--------LRW-------TRHLAR--------LCGWLVMPRKTQEEERR 362
                     ::.:.||        .||       ..|::.        |...:|...:.|:..|.
  Fly    62 DVELYFGGEYISNYPPQSYRCPYCKRWGFNESTFLEHVSAMHPDASPLLVSTMVGLFEQQQAARL 126

  Fly   363 GFCNAQESGPALGQSAATPIPA---------------------------ETRSVRSQCQEKDRTV 400
            ...|.|.:..|:..::...:..                           |.||.|.....:||..
  Fly   127 FLENEQLASIAVAATSRNELMRRPEGSMALYLEPLNRDGSYRRVVERNNEDRSRRLSPDGRDRLQ 191

  Fly   401 VLQQQQQELCSLTGLASEASSRLQSIIDRLLLQNAKLETQLQTVATASSSEISQFLSAHQCFLLQ 465
            .|.:::     .:.:|..:::|:.::..|.||..|..:       .:..|.|.:.:.|.|.....
  Fly   192 ALVRER-----YSRIARRSAARVGNMTSRPLLAPAPGD-------GSRLSGIQESIEAGQGIRNV 244

  Fly   466 IIEDMRQLSH---------ASA---------VTSPPP---APAAQVAPSAAPLVS-------STF 502
            |:|::...::         |||         |..|.|   ||.....||...::.       ..|
  Fly   245 IVEELSTSNYDPPFTINASASAILEQQQQQQVMGPSPNAAAPPIVTHPSLIEMMRFYDEAGLQPF 309

  Fly   503 LSSSTPQRQMLFDMYA----PVG--ANLTHSINGADLNRSYLEANKSDYSLNDISLW-FDQR-RS 559
            .:||   |:::...:|    |..  .|.|.|||......::.:|:.:..||....|: .|:| |.
  Fly   310 PASS---RRVIRTRHANPAQPAANIGNNTRSINVYGPTSAFTQASHNTRSLTAPDLFSLDERYRI 371

  Fly   560 SVQP--GQGPGSL---------------------PAPLPLPMPLGALLEQQPANGGDGRDTEMVN 601
            |..|  ...||:|                     |....||:.||....:.|:.....||.|...
  Fly   372 SRMPMFQANPGALHRQGTGTRALDTRAVEFSEFPPEETELPLILGTSTIEDPSKLTKQRDQERRR 436

  Fly   602 FKLLLHKVKEIVEDSYSDNAELSAATQNLENVLDSIIKSEEQQ 644
            |  |.::...........|..|....:.:..||.|.:..|:.|
  Fly   437 F--LCYRFTTPRSSKRPQNHFLLQRAEFVSQVLYSALCDEDFQ 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dahNP_511162.1 EF-hand_2 44..168 CDD:286194
ZZ_dah 281..329 CDD:239085 13/47 (28%)
CG15286NP_001285929.1 ZZ_PCMF_like 9..57 CDD:239078 15/57 (26%)
zf-Di19 78..>107 CDD:283297 3/28 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.