DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Top1 and AT4G26701

DIOPT Version :9

Sequence 1:	NP_001014742.1	Gene:	Top1 / 32458	FlyBaseID:	FBgn0004924	Length:	974	Species:	Drosophila melanogaster
Sequence 2:	NP_001119063.1	Gene:	AT4G26701 / 6241184	AraportID:	AT4G26701	Length:	69	Species:	Arabidopsis thaliana

Alignment Length:	60	Identity:	34/60 - (56%)
Similarity:	49/60 - (81%)	Gaps:	0/60 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   906 QLKKLELQETDRDENKTIALGTSKLNYLDPRISVAWCKKHDVPIEKIFNKTQRTKFLWAV 965
            :::|:|.....:::.||:||||||:||:||||:|||||:|:.||||||||:...||.||:
plant     2 KIEKMERDMQTKEDLKTVALGTSKINYMDPRITVAWCKRHEAPIEKIFNKSLLEKFAWAM 61

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Top1	NP_001014742.1	Topoisomer_IB_N_htopoI_like	441..655	CDD:239570
		TOPEUc	585..946	CDD:214661	21/39 (54%)
		Topoisom_I	657..859	CDD:279380
		Topo_C_assoc	905..972	CDD:291068	34/60 (57%)
AT4G26701	NP_001119063.1	Topo_C_assoc	2..67	CDD:405119	34/60 (57%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	89	1.000	Domainoid score	I2690
eggNOG	1	0.900	-	-		E1_COG3569
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.810