powered by:
Protein Alignment Top1 and AT4G26701
DIOPT Version :9
Sequence 1: | NP_001014742.1 |
Gene: | Top1 / 32458 |
FlyBaseID: | FBgn0004924 |
Length: | 974 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001119063.1 |
Gene: | AT4G26701 / 6241184 |
AraportID: | AT4G26701 |
Length: | 69 |
Species: | Arabidopsis thaliana |
Alignment Length: | 60 |
Identity: | 34/60 - (56%) |
Similarity: | 49/60 - (81%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 906 QLKKLELQETDRDENKTIALGTSKLNYLDPRISVAWCKKHDVPIEKIFNKTQRTKFLWAV 965
:::|:|.....:::.||:||||||:||:||||:|||||:|:.||||||||:...||.||:
plant 2 KIEKMERDMQTKEDLKTVALGTSKINYMDPRITVAWCKRHEAPIEKIFNKSLLEKFAWAM 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
89 |
1.000 |
Domainoid score |
I2690 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3569 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.