DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gce and tai

DIOPT Version :9

Sequence 1:NP_001188593.1 Gene:gce / 32457 FlyBaseID:FBgn0261703 Length:959 Species:Drosophila melanogaster
Sequence 2:NP_001245949.1 Gene:tai / 34242 FlyBaseID:FBgn0041092 Length:2047 Species:Drosophila melanogaster


Alignment Length:337 Identity:68/337 - (20%)
Similarity:93/337 - (27%) Gaps:118/337 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RSRNSSTSHSQGRGQDIEDLKQDIPYFDEP-----PALDADLLVLGKSECQLDELAWDRDADGDA 65
            ||...|...:||..          |.|.:|     |.....|....::..|..:||:.:...||.
  Fly  1610 RSAPYSPQPNQGYA----------PQFPQPGQRLSPQQQQQLSQQQQNNVQQQQLAYQQQQVGDG 1664

  Fly    66 DAPLETAPAVDLEEDNYPDENESSVLGSDYAPSGSGSGANSFYQSPTPSATGSGCDLMLRPPSNS 130
                                      |....|.||.||..|.....:|...|||..         
  Fly  1665 --------------------------GRSNTPFGSNSGMQSPGMQNSPQQWGSGGG--------- 1694

  Fly   131 MYHFNYRSPGSPMPVAPG-----------VTNSRGLHPY------------AHSP---AHGNPPG 169
                ....||.|:|....           :...:|:.||            .:||   ..|..|.
  Fly  1695 ----GGGGPGGPLPSGNAGRTLQQHNPMLIAQLQGVSPYNARQYQQNQRRGLNSPGAVGPGGNPA 1755

  Fly   170 FYPNMWYPNAPYGSAGAAGSAGGAVS-GGRYMGYGPGGVPGGTN--------------------- 212
            ....:...|:..|..|     |||.: .|..:|:|....|.|||                     
  Fly  1756 AQAALQRQNSFQGQGG-----GGATTPDGSGVGFGGPQSPYGTNVNVFQQQQLQRLQRQGSVPQA 1815

  Fly   213 -----------SGPGAGPGAMQAAYPGHSAHMHALHHQYPQPHPHAHHPQHPHHSPHPHHPHPHE 266
                       |.||:......:|..|:.........|..|.|....|.|..:......|||||.
  Fly  1816 TQHLPGSPRFGSSPGSSNNTDSSAAAGNQQQQQQQQQQQQQQHQQQQHQQLMNGLSMSPHPHPHP 1880

  Fly   267 TMMEMFQLSNSG 278
            .||.:..:.:.|
  Fly  1881 AMMGVGGMGSGG 1892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gceNP_001188593.1 HLH 279..325 CDD:238036 68/337 (20%)
PAS 352..>405 CDD:238075
PAS_11 539..646 CDD:291273
taiNP_001245949.1 HLH 235..286 CDD:238036
PAS 377..442 CDD:214512
PAS_11 591..711 CDD:291273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.