DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9101 and chchd6b

DIOPT Version :9

Sequence 1:NP_573011.1 Gene:CG9101 / 32452 FlyBaseID:FBgn0030622 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_005168759.1 Gene:chchd6b / 492522 ZFINID:ZDB-GENE-041114-95 Length:233 Species:Danio rerio


Alignment Length:207 Identity:35/207 - (16%)
Similarity:67/207 - (32%) Gaps:60/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GAQLAGETRAEGGGAGPGTGPHPPQKQDSTTKRSEKSDQTEKALPGQTKQEPDGQPIPKQEYPQP 66
            |.:|:||.......:||.:......|.:|....:|.|..:......:.|:..:.:.:..||    
Zfish    26 GVKLSGEVLQRMRESGPASSKPASNKAESAKAETEASRASAAETQEELKRRFEREQVLVQE---- 86

  Fly    67 MPVSRRLIRSRSFTTDIQ-----------------RMP-------------------TEAIYAE- 94
             .:||...|.|....|.|                 .:|                   .|..|.| 
Zfish    87 -ELSRISQRERESAADEQNTAVLREKTQRQLNNTHNLPDELSFRARQLKKKENELKHLEQFYKEQ 150

  Fly    95 ------------------FDRLIQQVEGHLGPVAVESPCLDVAARLQSCLQAHRQRSCNCFAAME 141
                              :::...:.|..:.|..:...|.::.:::.||.:.::.:|..|.....
Zfish   151 LQLMEKKNSEYYQQNLHMYEKEADKAEATVRPRPMSPVCSELQSQVLSCYRLNKHQSLLCSQIAR 215

  Fly   142 EYRNCVVRATQN 153
            ||.||:..:.:|
Zfish   216 EYMNCINSSKKN 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9101NP_573011.1 None
chchd6bXP_005168759.1 DUF737 16..181 CDD:283062 24/159 (15%)
ATP-synt_B <50..>116 CDD:304375 13/70 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.