DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9101 and chchd3a

DIOPT Version :9

Sequence 1:NP_573011.1 Gene:CG9101 / 32452 FlyBaseID:FBgn0030622 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_009298536.1 Gene:chchd3a / 407730 ZFINID:ZDB-GENE-030131-5005 Length:429 Species:Danio rerio


Alignment Length:131 Identity:26/131 - (19%)
Similarity:49/131 - (37%) Gaps:22/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EKSDQTEKALPGQTKQ--------EPDGQPIPKQEYPQPMPVSRRLIRSRSF---TTDIQRMPTE 89
            |:....::.|..|..|        |...:.:.||:......|::...||..|   |.:......:
Zfish   306 ERVSAEDERLQAQIYQMERKARQLEERDKELRKQDAFYREQVAKLKERSSQFYKVTNENYHKAAD 370

  Fly    90 AIYAEFDRLIQQVEGHLGPVAVESPCLDVAARLQSCLQAHRQRSCNCFAAMEEYRNCVVRATQNR 154
            .:.|:|.|.      .:.||     |.|:..::..|.:.:..::..|.....:|..||..|.|.:
Zfish   371 EVNAKFKRY------EISPV-----CTDLQGQILKCYRENAGKTLLCSNIASQYLQCVNHAKQEK 424

  Fly   155 V 155
            :
Zfish   425 L 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9101NP_573011.1 None
chchd3aXP_009298536.1 DUF737 209..377 CDD:283062 13/70 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.