DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9101 and Chchd3

DIOPT Version :9

Sequence 1:NP_573011.1 Gene:CG9101 / 32452 FlyBaseID:FBgn0030622 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_017448014.1 Gene:Chchd3 / 296966 RGDID:1310325 Length:232 Species:Rattus norvegicus


Alignment Length:126 Identity:32/126 - (25%)
Similarity:57/126 - (45%) Gaps:13/126 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SEKSDQTEKALPGQTK----QEPDGQPIPKQEYPQPMPVSRRLIRSRSFTTDIQRMPTEAIYAEF 95
            ||::....|.|..:.|    :|.| :.|.||:......:||...||..|    .::.||    |:
  Rat   113 SEENRTKVKHLDIEDKARQLEEKD-RMIRKQDAFYKEQLSRLEERSSEF----YKVTTE----EY 168

  Fly    96 DRLIQQVEGHLGPVAVESPCLDVAARLQSCLQAHRQRSCNCFAAMEEYRNCVVRATQNRVD 156
            .:..::||...........|.|:..::..|.:.:.|::.:|.|...:|.:||..|.||.::
  Rat   169 QKAAEEVESKFRRYEYHPVCADLQTKILQCYRQNTQQTLSCSALANQYMHCVNHAKQNMLE 229



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.