DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5662 and Mtx3

DIOPT Version :9

Sequence 1:NP_001285266.1 Gene:CG5662 / 32450 FlyBaseID:FBgn0030620 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_003749215.1 Gene:Mtx3 / 688905 RGDID:1583002 Length:311 Species:Rattus norvegicus


Alignment Length:282 Identity:72/282 - (25%)
Similarity:107/282 - (37%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LPE-RSSCLAVKTFLRMCNLPFTEHISDNAEFMSPGGRLTHLPLLRLGPVKTFAEFEPIVAQVEA 105
            ||. .|..|.|..:.:....|...:|.||. :..|.|   .:|:|        ...:.||::.|.
  Rat    16 LPSVHSESLVVLAYAKFSGAPLKVNIIDNT-WRGPRG---DVPIL--------TTEDSIVSKPEK 68

  Fly   106 VQGGNCLDSWMSEDQRDNIRCLVSYVENVFTLAEI------------HMSFVDEVNYQLYTATRC 158
            :.  |.|     ..|:.|..|.:|..:...|||.|            |..:|:..||...|....
  Rat    69 IL--NFL-----RKQKFNADCELSAKQGADTLAYIALLEEKLLPGVLHTFWVENDNYFTVTKPWF 126

  Fly   159 AAAHPWPLSTIRRFAKQKDA-QKIL------KVYRWQDLDNDQVIQEVSICADALIAELEEDQAK 216
            |:..|:|||.|......:.| .:||      .:|..||:: .|:.::...|.:.|...|...|  
  Rat   127 ASRIPFPLSLILPGRMSRGALNRILLTRGVPPLYHVQDVE-AQIYRDAKECLNLLSNRLGTSQ-- 188

  Fly   217 SYFGGSRPCKLDALVFGHVVAIMTTKLPNMELAAVLATYPRLLAHCRRIDQSLF----------- 270
             :|.|..|..|||.|||.:..:...:.|.:.|...|...|.|...|..|..|.|           
  Rat   189 -FFFGDTPSTLDAYVFGFLAPLYKVRFPKVHLQEHLKQLPNLCRLCDDILDSYFRHGAGGISPAG 252

  Fly   271 ---DGKL--LTSAVEEQEDEME 287
               |..|  ||..|.::.:.:|
  Rat   253 QEVDANLQKLTQLVNKESNLIE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5662NP_001285266.1 GST_N_Metaxin2 29..106 CDD:239377 16/64 (25%)
GST_C_Metaxin2 138..266 CDD:198320 39/146 (27%)
Mtx3XP_003749215.1 Tom37 23..142 CDD:402277 34/137 (25%)
GST_C_Metaxin1_3 105..241 CDD:198321 39/139 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.