DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5662 and CG9393

DIOPT Version :9

Sequence 1:NP_001285266.1 Gene:CG5662 / 32450 FlyBaseID:FBgn0030620 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster


Alignment Length:237 Identity:56/237 - (23%)
Similarity:93/237 - (39%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CLAVKTFLRMCNLPFTEHISDNAEFMSPGGRLTHLPLLRLGPVKTFAEFEPI--VAQVEAVQGGN 110
            ||.....||....|.....|.| ...|..|:   ||.|::|..| ||.:..|  |..:|    |.
  Fly    25 CLRALCLLRFTRCPMDVQTSSN-PLRSGAGK---LPYLQIGNQK-FAGYRQIKRVLDLE----GY 80

  Fly   111 CLDSWMSEDQRDNIRCLVSYVENVFTLAEIH-----MSFVDEVNYQLYTATRCAAAHPWPLSTIR 170
            .:|:.:|..|:   ....:|...|||  .:|     ..|.:..|:...|....|...|:|.:...
  Fly    81 PIDAHLSTKQK---HLSTAYANWVFT--NLHAYYHYFLFGEPHNFDTTTRGLYAKRTPFPFNFYY 140

  Fly   171 RFAKQKDAQKILKVYRWQDL-------DNDQVIQEVSICADALIAELEEDQAKSYFGGSRPCKLD 228
            ..:.|::|..:::|....|:       :.|.::.......:.|..:|..   |.:|.|....:.|
  Fly   141 PSSYQREACDVVQVMAGFDVNDKLDKHEGDYLVVNAKKVVNLLSRKLGR---KVWFFGDTYSEFD 202

  Fly   229 ALVFGHVVAIMTTKLPNMELAAVLATYPRLLAHCRRIDQSLF 270
            |:|:.::..|....|||..|...:.....|:....||.:.:|
  Fly   203 AIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5662NP_001285266.1 GST_N_Metaxin2 29..106 CDD:239377 19/59 (32%)
GST_C_Metaxin2 138..266 CDD:198320 27/139 (19%)
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 19/62 (31%)
GST_C_Metaxin1_3 108..244 CDD:198321 27/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12289
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.