DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5662 and mtx3

DIOPT Version :9

Sequence 1:NP_001285266.1 Gene:CG5662 / 32450 FlyBaseID:FBgn0030620 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_991184.1 Gene:mtx3 / 402916 ZFINID:ZDB-GENE-021210-3 Length:313 Species:Danio rerio


Alignment Length:206 Identity:46/206 - (22%)
Similarity:73/206 - (35%) Gaps:54/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 AEFEPIVAQVEAVQGGNCLDSWMSEDQRDNIRCLVSYVENVFTLAEIHMSFVDEVNYQLYTATRC 158
            |:||     :.|.||.:.:             ..::.:|.....|.:|..:||..||...|    
Zfish    80 ADFE-----LTAKQGADTM-------------AYIALLEEKLRPALLHTFWVDAENYANLT---- 122

  Fly   159 AAAHPW-------PLS----------TIRRFAKQKDAQKILKVYRWQDLDNDQVIQEVSICADAL 206
               .||       ||:          .:.|....|....:|.:...:    .::..|...|.:.|
Zfish   123 ---RPWFTSHSLFPLNFFVPGRQASLALSRILLTKAESPLLNITEVE----GKIYSEAKECLNLL 180

  Fly   207 IAELEEDQAKSYFGGSRPCKLDALVFGHVVAIMTTKLPNMELAAVLATYPRLLAHCRRIDQSLFD 271
            ...|..   .::|.|..|..|||.||||:..::...||:.:|...|.....|...|..|.::   
Zfish   181 SHRLGN---FNFFFGDTPTSLDAFVFGHIAPLIKAPLPSGQLQKHLNQLDNLCQFCNTILKN--- 239

  Fly   272 GKLLTSAVEEQ 282
              .||.|..|:
Zfish   240 --YLTDATAEK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5662NP_001285266.1 GST_N_Metaxin2 29..106 CDD:239377 3/11 (27%)
GST_C_Metaxin2 138..266 CDD:198320 34/144 (24%)
mtx3NP_991184.1 GST_N_Metaxin1_like 5..77 CDD:239376
GST_C_Metaxin1_3 105..241 CDD:198321 35/154 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.