Sequence 1: | NP_001285266.1 | Gene: | CG5662 / 32450 | FlyBaseID: | FBgn0030620 | Length: | 292 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_991184.1 | Gene: | mtx3 / 402916 | ZFINID: | ZDB-GENE-021210-3 | Length: | 313 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 46/206 - (22%) |
---|---|---|---|
Similarity: | 73/206 - (35%) | Gaps: | 54/206 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 94 AEFEPIVAQVEAVQGGNCLDSWMSEDQRDNIRCLVSYVENVFTLAEIHMSFVDEVNYQLYTATRC 158
Fly 159 AAAHPW-------PLS----------TIRRFAKQKDAQKILKVYRWQDLDNDQVIQEVSICADAL 206
Fly 207 IAELEEDQAKSYFGGSRPCKLDALVFGHVVAIMTTKLPNMELAAVLATYPRLLAHCRRIDQSLFD 271
Fly 272 GKLLTSAVEEQ 282 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5662 | NP_001285266.1 | GST_N_Metaxin2 | 29..106 | CDD:239377 | 3/11 (27%) |
GST_C_Metaxin2 | 138..266 | CDD:198320 | 34/144 (24%) | ||
mtx3 | NP_991184.1 | GST_N_Metaxin1_like | 5..77 | CDD:239376 | |
GST_C_Metaxin1_3 | 105..241 | CDD:198321 | 35/154 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 280..313 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D422112at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |