DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5662 and Mtx3

DIOPT Version :9

Sequence 1:NP_001285266.1 Gene:CG5662 / 32450 FlyBaseID:FBgn0030620 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001156417.1 Gene:Mtx3 / 382793 MGIID:2686040 Length:312 Species:Mus musculus


Alignment Length:281 Identity:65/281 - (23%)
Similarity:101/281 - (35%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LPE-RSSCLAVKTFLRMCNLPFTEHISDNAEFMSPGGRLTHLPLL--------RLGPVKTFAEFE 97
            ||. .|..|.|..:.:....|...:|.||....|.|    .:|:|        :...:..|...:
Mouse    16 LPSVHSESLVVLAYAKFSGAPLKINIIDNTWRGSRG----DVPILTTEDSIVSKPAKILNFLRKQ 76

  Fly    98 PIVAQVE--AVQGGNCLDSWMSEDQRDNIRCLVSYVENVFTLAEIHMSFVDEVNYQLYTATRCAA 160
            ...|..|  |.||.:.|             ..::.:|.....|.:|..:|:..||...|....|:
Mouse    77 K
YNADCELSAKQGADTL-------------AYIALLEEKLLPAVLHTFWVENENYFTVTKPWFAS 128

  Fly   161 AHPWPLSTIRRFAKQKDA-QKIL------KVYRWQDLDNDQVIQEVSICADALIAELEEDQAKSY 218
            ..|:|||.|......:.| .:||      .:|..|::: .|:.::...|.:.|...|...|   :
Mouse   129 RIPFPLSLILPGRMSRGALNRILLTRGEPPLYHVQEVE-AQIYRDARECLNLLSNRLGTSQ---F 189

  Fly   219 FGGSRPCKLDALVFGHVVAIMTTKLPNMELAAVLATYPRLLAHCRRI---------------DQS 268
            |.|..|..|||.|||.:..:.....|.:.|...|.....|...|..|               .|.
Mouse   190 FFGDTPSTLDAYVFGFLAPLYKVSFPKVHLQKHLKQLCNLCRFCDDILDSYFRPGPGGVSPAGQE 254

  Fly   269 LFDGKL--LTSAVEEQEDEME 287
            :.|..|  ||..|.::.:.:|
Mouse   255 MVDANLQKLTQLVNKESNLIE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5662NP_001285266.1 GST_N_Metaxin2 29..106 CDD:239377 16/74 (22%)
GST_C_Metaxin2 138..266 CDD:198320 37/149 (25%)
Mtx3NP_001156417.1 GST_N_Metaxin1_like 5..77 CDD:239376 14/64 (22%)
GST_C_Metaxin1_3 105..241 CDD:198321 37/139 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.