DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5662 and Mtx1

DIOPT Version :9

Sequence 1:NP_001285266.1 Gene:CG5662 / 32450 FlyBaseID:FBgn0030620 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_008759357.1 Gene:Mtx1 / 295241 RGDID:1559791 Length:503 Species:Rattus norvegicus


Alignment Length:329 Identity:79/329 - (24%)
Similarity:123/329 - (37%) Gaps:83/329 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NLTAALMQSSAEEGKSEEAWPADAHLHQPAEANQLLLPERSSC---------------------- 48
            :|...|..::..|.:...:|      .:.|:|.:.:||.:..|                      
  Rat   108 SLDLKLRVATQAETRGCSSW------REKADAYERVLPGQRMCKMAAPMELFCWSGGWGLPSVDL 166

  Fly    49 --LAVKTFLRMCNLPFTEHISDNAEFMSPGGRLTHLPLLRLGPVKTFAEFEPIVA---------- 101
              |||.|:.|....|...|...| .:.||.|.   ||.||....|...|...|:.          
  Rat   167 DSLAVLTYTRFTCAPLKVHKISN-PWQSPSGT---LPALRTSSGKVITEPHKIITHLRKEKYNAD 227

  Fly   102 -QVEAVQGGNCLD--SWMSED-----------QRDNIR-------CLVS----YVENVFTLA--- 138
             .:.|.||.:.|.  |.:.|.           |.|.:|       |.||    ..::||...   
  Rat   228 YDLSARQGADTLAFISLLEEKLLPMLVSTPSLQGDILRVPGDLVACPVSGSCTGSDSVFLSVCPI 292

  Fly   139 EIHMSFVDEVNYQLYTATRCAAAHPWPLSTI---RRFAKQKDAQKIL----KVYRWQDLDNDQVI 196
            :||..::|..||...|....|.|.|:||:..   |...:..:..::|    ::...::|:. ::.
  Rat   293 QIHTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRRHMERLQLLCGEHRLESEEELEK-ELY 356

  Fly   197 QEVSICADALIAELEEDQAKSYFGGSRPCKLDALVFGHVVAIMTTKLPNMELAAVLATYPRLLAH 261
            ||...|...|...|   .::.:|.|..|..|||.||.|:|.::..|||:.:|.|.|.....|..:
  Rat   357 QEARECLTLLSHRL---GSRKFFFGDAPASLDAFVFSHLVLLLQAKLPSGKLQAHLRGLQNLCVY 418

  Fly   262 CRRI 265
            |..|
  Rat   419 CTHI 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5662NP_001285266.1 GST_N_Metaxin2 29..106 CDD:239377 23/111 (21%)
GST_C_Metaxin2 138..266 CDD:198320 38/138 (28%)
Mtx1XP_008759357.1 GST_N_Metaxin1_like 150..223 CDD:239376 18/76 (24%)
GST_C_Metaxin1_3 291..427 CDD:198321 38/136 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.