DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5662 and cdr-3

DIOPT Version :9

Sequence 1:NP_001285266.1 Gene:CG5662 / 32450 FlyBaseID:FBgn0030620 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_506115.2 Gene:cdr-3 / 183780 WormBaseID:WBGene00008297 Length:278 Species:Caenorhabditis elegans


Alignment Length:159 Identity:29/159 - (18%)
Similarity:55/159 - (34%) Gaps:62/159 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 IRRFAKQKDAQKIL-----------KVYRWQDLDND------------QVIQEVSI--------- 201
            |....|:|:||.:.           .:.|::..|||            :::|.:.:         
 Worm   119 ISSLPKEKEAQSVAITRLADNHLFNVLLRYKTSDNDFYYTLLGNMGVPKILQPICLPFIKAAFVK 183

  Fly   202 -----------------CADALIAELEEDQAKSYFG------GSRPCKLDALVFGHVVAIMTTKL 243
                             ..|.|..:|:..|  .|.|      |......||.|||.:..::   .
 Worm   184 KAYERSTRAIGDFEQTDLDDILHRDLQTIQ--DYLGEQKFLFGDEVKAADAAVFGQLATVI---Y 243

  Fly   244 P-NMELAAVLAT-YPRLLAHCRRIDQSLF 270
            | ..::..:|.. :|:||.:|.|:.:.::
 Worm   244 PFRCKINDILENDFPQLLEYCERVRKEIY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5662NP_001285266.1 GST_N_Metaxin2 29..106 CDD:239377
GST_C_Metaxin2 138..266 CDD:198320 29/153 (19%)
cdr-3NP_506115.2 GST_N_Metaxin_like 46..117 CDD:239378
GST_C_Metaxin <200..268 CDD:198302 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.