DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5662 and Y57A10A.26

DIOPT Version :9

Sequence 1:NP_001285266.1 Gene:CG5662 / 32450 FlyBaseID:FBgn0030620 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_496604.1 Gene:Y57A10A.26 / 174868 WormBaseID:WBGene00013266 Length:269 Species:Caenorhabditis elegans


Alignment Length:268 Identity:57/268 - (21%)
Similarity:105/268 - (39%) Gaps:56/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WPADAHLHQPAEANQLLLPERSSCL--------AVKTFLRMCNLPFTEHISDNAEFMSPGGRLTH 81
            |..| |::       |:...|:.|:        .|:||||:.::|:| :|::..:.||..|:   
 Worm    11 WEKD-HVY-------LVQFPRAGCIPSPSPYAFKVETFLRVADIPYT-NINNEFKKMSARGQ--- 63

  Fly    82 LPLLRLGPVKTFAEFEPIVAQVEAVQGGNCLDSWMSEDQRDNIRCLVSYVENVFTLAEIHMSFVD 146
            :|.:.|.. :..|:...|:        .|..:.:...|..|......:.....|.|.|.|:.:| 
 Worm    64 IPFIELNG-RQHADSTIII--------DNLTEHFHKSDLEDLSASDKAIARAFFALLEHHLCWV- 118

  Fly   147 EVNYQLYT--------ATRCAAAHPWPLSTIRRFA-KQKDAQKILKVYRWQ-------DLDNDQV 195
                .||:        ||......  .|:.|:.|| |....:...|..|.:       ....::|
 Worm   119 ----SLYSRGQDFGWLATDTGFGR--LLTGIKGFAFKNFIVKSFTKKVRGRAAAQGMGTFSREEV 177

  Fly   196 IQEVSICADALIAELEEDQAKSYFGGSRPCKLDALVFGHVVAIMTTKLPNMELAAVL-ATYPRLL 259
            :.:.....||:..:|.:   |.|..||....:|...|.|:..::.|...:.|:.|.: ...|.::
 Worm   178 LDQAKKDLDAISTQLGD---KPYLFGSSIKTIDVTAFAHLAELIYTPQFSPEIRAYIDEKVPNVM 239

  Fly   260 AHCRRIDQ 267
            .:..||.:
 Worm   240 EYVIRIKE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5662NP_001285266.1 GST_N_Metaxin2 29..106 CDD:239377 19/84 (23%)
GST_C_Metaxin2 138..266 CDD:198320 30/144 (21%)
Y57A10A.26NP_496604.1 GST_N_Metaxin_like 15..89 CDD:239378 20/93 (22%)
GST_C_Metaxin <176..246 CDD:198302 16/72 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.