Sequence 1: | NP_001285266.1 | Gene: | CG5662 / 32450 | FlyBaseID: | FBgn0030620 | Length: | 292 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_493569.1 | Gene: | mtx-1 / 173340 | WormBaseID: | WBGene00009559 | Length: | 312 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 48/206 - (23%) |
---|---|---|---|
Similarity: | 95/206 - (46%) | Gaps: | 14/206 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 RMCNLPFTEHISDNAEFMSPGGRLTHLPLLRL--GPVKTFAEFEPIVAQVEAVQGGNCLDSWMSE 118
Fly 119 DQRDNIRCLVSYVENVFTLAEIHMSFVDEVNYQLYTATRCAAAHPWPLSTIRRFAKQKDAQKILK 183
Fly 184 VYRWQDLDNDQVIQEVSICADALIAELEEDQAKSYFGGSRPCKLDALVFGHVVAIMTTKLPNMEL 248
Fly 249 AAVLATYPRLL 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5662 | NP_001285266.1 | GST_N_Metaxin2 | 29..106 | CDD:239377 | 14/51 (27%) |
GST_C_Metaxin2 | 138..266 | CDD:198320 | 32/122 (26%) | ||
mtx-1 | NP_493569.1 | GST_N_Metaxin1_like | 1..76 | CDD:239376 | 14/52 (27%) |
GST_C_Metaxin1_3 | 106..231 | CDD:198321 | 32/123 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D422112at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |