DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5662 and mtx-1

DIOPT Version :9

Sequence 1:NP_001285266.1 Gene:CG5662 / 32450 FlyBaseID:FBgn0030620 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_493569.1 Gene:mtx-1 / 173340 WormBaseID:WBGene00009559 Length:312 Species:Caenorhabditis elegans


Alignment Length:206 Identity:48/206 - (23%)
Similarity:95/206 - (46%) Gaps:14/206 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RMCNLPFTEHISDNAEFMSPGGRLTHLPLLRL--GPVKTFAEFEPIVAQVEAVQGGNCLDSWMSE 118
            :||..| ...|.....:.||.|   .||::..  |..|...:||..|..::.......:|:.::.
 Worm    27 KMCASP-VRVIQSTRPWRSPSG---ELPMVAQTEGEAKPVTDFEKFVDILKKCGQDVVIDADLTT 87

  Fly   119 DQRDNIRCLVSYVENVFTLAEIHMSFVDEVNYQLYTATRCAAAHPWPLSTIRRFAKQKDAQKILK 183
            .::..:.....|:.:....|.:|..:.||:||...|....|:...:|.:......::|.|.::| 
 Worm    88 IEKAQLDAFSCYLHHNLYPAVMHTFWTDELNYNTVTQYWYASHLHFPYNLYYLEKRRKKALRLL- 151

  Fly   184 VYRWQDLDNDQVIQEVSICADALIAELEEDQAKSYFGGSRPCKLDALVFGHVVAIMTTKLPNMEL 248
                ...::.::::|..:..:.|..:|.:::   :|.|::|..|||||||::..::...|||..|
 Worm   152 ----AGKNDTEILKEAFMALNTLSTKLGDNK---FFCGNKPTSLDALVFGYLAPLLRVPLPNDRL 209

  Fly   249 AAVLATYPRLL 259
            ...|:..|.|:
 Worm   210 QVQLSACPNLV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5662NP_001285266.1 GST_N_Metaxin2 29..106 CDD:239377 14/51 (27%)
GST_C_Metaxin2 138..266 CDD:198320 32/122 (26%)
mtx-1NP_493569.1 GST_N_Metaxin1_like 1..76 CDD:239376 14/52 (27%)
GST_C_Metaxin1_3 106..231 CDD:198321 32/123 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.