DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9095 and SELL

DIOPT Version :9

Sequence 1:NP_001096984.1 Gene:CG9095 / 32447 FlyBaseID:FBgn0030617 Length:1141 Species:Drosophila melanogaster
Sequence 2:NP_000646.3 Gene:SELL / 6402 HGNCID:10720 Length:372 Species:Homo sapiens


Alignment Length:346 Identity:82/346 - (23%)
Similarity:135/346 - (39%) Gaps:92/346 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 LASYNGKCYIF-YNRQPLNFLDALSFCRSRGGTLISESNPALQGFISWEL-WRRHRSDVSSQYWM 316
            ||.:...|:.: |:.:|:|:..|..|||.....|::..|.|...::...| :.|      |.||:
Human    31 LAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSR------SYYWI 89

  Fly   317 GAVRDGSDRSSWKWVNGDELTVSFWSHPGGD---------EDCARF------DGSKGWLWSDTNC 366
            |..:.|   ..|.|| |...:::..:...||         |||...      |..|   |:|..|
Human    90 GIRKIG---GIWTWV-GTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGK---WNDDAC 147

  Fly   367 NTLLNFIC---QHQPKTC-GRPEQPPNSTMVALNGFEVGAQIKYSCDANHLLVGPATRTCLETGF 427
            :.|...:|   ..||.:| |..|     .:..:|        .|:|:.             :.|:
Human   148 HKLKAALCYTASCQPWSCSGHGE-----CVEIIN--------NYTCNC-------------DVGY 186

  Fly   428 YNEFPPVCKYI--------------ECGLPASIAHGSYALLNNTVGYLSLVKYSCEEGYEMIGRA 478
            |.   |.|:::              :|..|.    |:::       :.|...:||.||..:.|..
Human   187 YG---PQCQFVIQCEPLEAPELGTMDCTHPL----GNFS-------FSSQCAFSCSEGTNLTGIE 237

  Fly   479 LLTCDFDERWNGPPPRCEIVECDTLPGNYYSTIINA--PNGTY-YGSKAEISCPPGYRMEGPRVL 540
            ..||.....|:.|.|.|::::|:.|...... |:|.  |..:: :.|.....|..|..:.|.:..
Human   238 ETTCGPFGNWSSPEPTCQVIQCEPLSAPDLG-IMNCSHPLASFSFTSACTFICSEGTELIGKKKT 301

  Fly   541 TCLASGQWSSALPRCIKLEPS 561
            .|.:||.||:..|.|.||:.|
Human   302 ICESSGIWSNPSPICQKLDKS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9095NP_001096984.1 CCP 37..93 CDD:153056
FTP 94..242 CDD:128870
CLECT 256..375 CDD:214480 34/138 (25%)
Sushi 381..435 CDD:278512 9/54 (17%)
CCP 440..496 CDD:153056 14/55 (25%)
CCP 500..556 CDD:153056 15/58 (26%)
SELLNP_000646.3 CCP 197..255 CDD:153056 14/68 (21%)
CCP 259..317 CDD:153056 15/58 (26%)
CLECT_selectins_like 39..157 CDD:153062 33/130 (25%)
EGF_CA <165..192 CDD:238011 9/55 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11997
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19325
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.