DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9095 and im:7151449

DIOPT Version :9

Sequence 1:NP_001096984.1 Gene:CG9095 / 32447 FlyBaseID:FBgn0030617 Length:1141 Species:Drosophila melanogaster
Sequence 2:XP_009300951.1 Gene:im:7151449 / 492708 ZFINID:ZDB-GENE-041111-283 Length:417 Species:Danio rerio


Alignment Length:412 Identity:112/412 - (27%)
Similarity:155/412 - (37%) Gaps:118/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 DCAR----FDGS-----KGWLWS--DTNCNTLLNFICQHQPKTCGRPEQPPNSTMVAL--NGFEV 400
            :|||    .|||     :...||  :..|..:          .||.|| |.:|.|..|  ||...
Zfish    54 ECARGYEAKDGSPLITCQNGKWSKVELKC
EKM----------DCGPPE-PQSSHMTYLINNGTLF 107

  Fly   401 GAQIKYSCDANHLLVGPATRTCLETGFYNEFPPVCKYIECGLPASIAHGSYALLNNTVGYLSLVK 465
            ||.:|..||..:.|.|.:.|.||.||:...  ..|..|.|..|....||: .:..:.|.|..::|
Zfish   108 GAYVKALCDTGYDLEGSSYRQCLVTGWNG
R--ATCTLITCDNPTPPEHGN-VMFRSPVLYNDVIK 169

  Fly   466 YSCEEGYEMIGRALLTCDFDERWNGPPPRCEIVECDTLP----GNYYSTIINAPNGTYYGSKAEI 526
            |||:|.|.::|...|||..|..:|.|||:||.:||. :|    ||  .|..|.|  ..:.|:|..
Zfish   170 YSCQENYTLVGNRSLTCGDDWDYNFPPPKCE
AIECG-VPTIKFGN--QTEGNPP--YLHKSQATF 229

  Fly   527 SCPPGYRMEGPRVLTCLASGQWSSALPRCIKLEPSTQPTAASTIPVPSSVATPPPFRPKVVSSTT 591
            .|.|||||.|.....|...| | ||||.|:|                   |||.|.....|..:.
Zfish   230 ECLPGYRMNGSATSVCEERG-W-SALPECVK-------------------ATPTPVSHSSVKMSI 273

  Fly   592 SRTPYRPAVSTASSGIGGSSTSTVGTYPSLSPTQVEINGESESEEEINVPPVPGTVREEFPPRRT 656
            |.||.  .|.|.::...||           |..:.:.||::.|...:                  
Zfish   274 SITPC--DVITFAANRNGS-----------SKFERDANGDAHSACSV------------------ 307

  Fly   657 VRPVLIPKKPNSTPA-ALPPTTHQVPPQPPSTYAPTPPRSSRPSGAPNSAGEVETTTRNTQQIIA 720
                        .|| :||..:..:.|:..:|..               |..|.|....|..:..
Zfish   308 ------------LPAFSLPFMSILLQPEETTTVV---------------ASTVTTDIATTNAVFC 345

  Fly   721 NSHPQDNEIPDS--VNIQQNQS 740
            ....::.|..:.  :.:.||.|
Zfish   346 KEEEEEEEEEEEHFITVSQNNS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9095NP_001096984.1 CCP 37..93 CDD:153056
FTP 94..242 CDD:128870
CLECT 256..375 CDD:214480 9/36 (25%)
Sushi 381..435 CDD:278512 22/55 (40%)
CCP 440..496 CDD:153056 21/55 (38%)
CCP 500..556 CDD:153056 23/59 (39%)
im:7151449XP_009300951.1 Sushi <39..82 CDD:278512 8/27 (30%)
Sushi 87..136 CDD:278512 22/49 (45%)
CCP 145..200 CDD:153056 21/55 (38%)
Sushi 204..256 CDD:278512 23/58 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0013219
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19325
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.