DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9095 and Cd46

DIOPT Version :9

Sequence 1:NP_001096984.1 Gene:CG9095 / 32447 FlyBaseID:FBgn0030617 Length:1141 Species:Drosophila melanogaster
Sequence 2:XP_008768071.1 Gene:Cd46 / 29333 RGDID:3061 Length:356 Species:Rattus norvegicus


Alignment Length:262 Identity:68/262 - (25%)
Similarity:105/262 - (40%) Gaps:58/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 KGWLWSDTNCNTLLNFICQHQPKTCGRPEQPPNSTMVALNG------------------------ 397
            ||:|:......|.   |||            ||.|.|.::.                        
  Rat    74 KGYLYLSPYPMTA---ICQ------------PNHTWVP
ISDHGCIKVQCTMLQDPSFGKVHYIDG 123

  Fly   398 -FEVGAQIKYSCDANHLLVGPATRTCLETG----FYNEFPPVCKYIECGLPASIAHGSYALLNNT 457
             |..||::||:|...:.:||.:...|...|    |:|..||.||.:.|..|..|.:|::...:..
  Rat   124 RFSWGARVKYTCMNGYYMVGMSVLQCELNGNGDAFWNGHPPSC
KKVYCLPPPKIKNGTHTFTDIK 188

  Fly   458 V-GYLSLVKYSCE-----EGYEMIGRALLTCDFDERWNGPPPRCEIVECDTLPGNYYSTIINAPN 516
            | .|...|.|||:     :.:.::|.::|.|.....|:..||.|::|:|..........|.....
  Rat   189 VFKYHEAVIYSCDPNPGPDKFSLVGPSMLFCAGHNTWSSDPPECK
VVKCPFPVLQNGRQISRTEK 253

  Fly   517 GTYYGSKAEISCPPGYRMEGPRVLTCLASGQWSSALPRCIK-LEP-STQPTAASTIPVPSSVATP 579
            ...|.:.....|..|:.|||..::.|.|...|..::|:|:| .:| ||:|      ||.|....|
  Rat   254 KFSYQALVLFQCLEGFYMEGSSMVVCGAKSSWEPSIPQCLKGPKPHSTKP------PVYSESGYP 312

  Fly   580 PP 581
            .|
  Rat   313 SP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9095NP_001096984.1 CCP 37..93 CDD:153056
FTP 94..242 CDD:128870
CLECT 256..375 CDD:214480 5/17 (29%)
Sushi 381..435 CDD:278512 18/82 (22%)
CCP 440..496 CDD:153056 16/61 (26%)
CCP 500..556 CDD:153056 12/55 (22%)
Cd46XP_008768071.1 CCP 43..96 CDD:153056 10/36 (28%)
Sushi 107..166 CDD:278512 14/58 (24%)
CCP 171..233 CDD:153056 16/61 (26%)
CCP 237..292 CDD:153056 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19325
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.