DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9095 and Sell

DIOPT Version :9

Sequence 1:NP_001096984.1 Gene:CG9095 / 32447 FlyBaseID:FBgn0030617 Length:1141 Species:Drosophila melanogaster
Sequence 2:XP_038946544.1 Gene:Sell / 29259 RGDID:3655 Length:460 Species:Rattus norvegicus


Alignment Length:335 Identity:76/335 - (22%)
Similarity:127/335 - (37%) Gaps:70/335 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 LASYNGKCYIF-YNRQPLNFLDALSFCRSRGGTLISESNPALQGFISWELWRRHRSDVSSQYWMG 317
            |..:...|:.: |:.:.:|:.:|..||:.....|:     |:|.....|...:......:.||:|
  Rat    89 LPHHGTHCWTYHYSERSMNWENARKFCKHNYTDLV-----AIQNKREIEYLEKTLPKNPTYYWIG 148

  Fly   318 AVRDGSDRSSWKWVNGDE-LT--VSFW-----SHPGGDEDCARF------DGSKGWLWSDTNCN- 367
            ..:.|   .:|.||..:: ||  ...|     ::....|||...      |..|   |:|..|: 
  Rat   149 IRKIG---KTWTWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGK---WNDDACHK 207

  Fly   368 --TLLNFICQHQPKTCGR----PEQPPNSTMVALNGFEVGAQIKYSCDANHLLVGPATRTCLETG 426
              ..|.:....||::|.|    .|...|:|.:              ||               .|
  Rat   208 RKAALCYTASCQPESCNRHGECVETINNNTCI--------------CD---------------PG 243

  Fly   427 FYNEFPPVCKY-IECGLPASIAHGSYALLN--NTVGYLSLVKYSCEEGYEMIGRALLTCDFDERW 488
            :|.   |.|:| |:|....:...|:...::  ....:.|...::|.||.|::|.|...|.....|
  Rat   244 YYG---PQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNW 305

  Fly   489 NGPPPRCEIVECDTLPGNYYSTI-INAPNGTY-YGSKAEISCPPGYRMEGPRVLTCLASGQWSSA 551
            ....|.|::::|..|......|: .:.|...: :.|....:|.....:.|.|...|.:||.|||.
  Rat   306 TYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSP 370

  Fly   552 LPRCIKLEPS 561
            .|.|.|.:.|
  Rat   371 SPICQKTKRS 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9095NP_001096984.1 CCP 37..93 CDD:153056
FTP 94..242 CDD:128870
CLECT 256..375 CDD:214480 29/136 (21%)
Sushi 381..435 CDD:278512 10/57 (18%)
CCP 440..496 CDD:153056 12/57 (21%)
CCP 500..556 CDD:153056 15/57 (26%)
SellXP_038946544.1 CLECT_selectins_like 97..215 CDD:153062 28/128 (22%)
EGF_CA 218..250 CDD:238011 12/63 (19%)
CCP 255..313 CDD:153056 12/57 (21%)
PHA02817 275..>384 CDD:165167 29/106 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19325
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.060

Return to query results.
Submit another query.