DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9095 and Sell

DIOPT Version :9

Sequence 1:NP_001096984.1 Gene:CG9095 / 32447 FlyBaseID:FBgn0030617 Length:1141 Species:Drosophila melanogaster
Sequence 2:XP_030108191.1 Gene:Sell / 20343 MGIID:98279 Length:387 Species:Mus musculus


Alignment Length:328 Identity:82/328 - (25%)
Similarity:131/328 - (39%) Gaps:68/328 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 LASYNGKCYIF-YNRQPLNFLDALSFCRSRGGTLISESNPALQGFISWELWRRHRSDVSSQYWMG 317
            |..:...|:.: |:.:|:|:.:|..||:.....|:     |:|.....|............||:|
Mouse    31 LIHHGTHCWTYHYSEKPMNWENARKFCKQNYTDLV-----AIQNKREIEYLENTLPKSPYYYWIG 90

  Fly   318 AVRDGSDRSSWKWVNGDE-LTVSFWSHPGGD-------EDCARF------DGSKGWLWSDTNCN- 367
            ..:.|   ..|.||..:: ||....:...|:       |||...      |..|   |:|..|: 
Mouse    91 IRKIG---KMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGK---WNDDACHK 149

  Fly   368 --TLLNFICQHQPKTC-GRPEQPPNSTMVALNGFEVGAQIKYSCDANHLLVGPATRTCL-ETGFY 428
              ..|.:....||.:| ||.|     .:..:|              ||        ||: :.|:|
Mouse   150 RKAALCYTASCQPGSCNGRGE-----CVETIN--------------NH--------TCICDAGYY 187

  Fly   429 NEFPPVCKY-IECGLPASIAHGSYALLN--NTVGYLSLVKYSCEEGYEMIGRALLTCDFDERWNG 490
            .   |.|:| ::|....:...|:...::  ....:.|...::|.||.|::|.|...|.....|:.
Mouse   188 G---PQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSS 249

  Fly   491 PPPRCEIVECDTLPGNYYSTI--INAPNGTY-YGSKAEISCPPGYRMEGPRVLTCLASGQWSSAL 552
            |.|.|::|:|:.|......|:  |: |.|.: :.||...:|..|..:.|.....|.|||.|||..
Mouse   250 PEPICQVVQCEPLEAPELGTMDCIH-PLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPE 313

  Fly   553 PRC 555
            |.|
Mouse   314 PIC 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9095NP_001096984.1 CCP 37..93 CDD:153056
FTP 94..242 CDD:128870
CLECT 256..375 CDD:214480 30/136 (22%)
Sushi 381..435 CDD:278512 12/55 (22%)
CCP 440..496 CDD:153056 13/57 (23%)
CCP 500..556 CDD:153056 20/59 (34%)
SellXP_030108191.1 CLECT_selectins_like 39..157 CDD:153062 29/128 (23%)
EGF_CA 160..192 CDD:238011 14/61 (23%)
CCP 197..255 CDD:153056 13/57 (23%)
CCP 259..317 CDD:153056 20/59 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12113
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19325
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
44.060

Return to query results.
Submit another query.