DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9095 and Cd46

DIOPT Version :9

Sequence 1:NP_001096984.1 Gene:CG9095 / 32447 FlyBaseID:FBgn0030617 Length:1141 Species:Drosophila melanogaster
Sequence 2:XP_006497297.1 Gene:Cd46 / 17221 MGIID:1203290 Length:376 Species:Mus musculus


Alignment Length:232 Identity:61/232 - (26%)
Similarity:105/232 - (45%) Gaps:26/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 SDTNCNTLLNFICQHQPKTCGRPEQPPNSTMVALNG-FEVGAQIKYSCDANHLLVGPATRTCLET 425
            ||..|..:          .|...:.|....:..::| |..||:.|::|...:.:||.:...|:..
Mouse   100 SDAGCIKV----------QCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLK 154

  Fly   426 G----FYNEFPPVCKYIECGLPASIAHGSYALLN-NTVGYLSLVKYSCE-----EGYEMIGRALL 480
            |    ::|.:||.|:.|.|..|..|.:|::.|.: |...|...|.|||:     :.:.::|.:::
Mouse   155 GDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMI 219

  Fly   481 TCDFDERWNGPPPRCEIVECDTLPGNYYSTIINAPNGTY-YGSKAEISCPPGYRMEGPRVLTCLA 544
            .|.....|:..||.|::|:|.. |......:|:.....: |.|.....|..|:.|||..::.|.|
Mouse   220 FCAGHNTWSNSPPECKVVKCPN-PVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSA 283

  Fly   545 SGQWSSALPRCIKLEPSTQPTAASTIPVPSSVATPPP 581
            :..|..::|:|:|....|.||..   ||.:....|.|
Mouse   284 NNSWEPSIPKCLKGPRPTHPTKP---PVYNYTGYPSP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9095NP_001096984.1 CCP 37..93 CDD:153056
FTP 94..242 CDD:128870
CLECT 256..375 CDD:214480 3/12 (25%)
Sushi 381..435 CDD:278512 15/58 (26%)
CCP 440..496 CDD:153056 16/61 (26%)
CCP 500..556 CDD:153056 14/56 (25%)
Cd46XP_006497297.1 PHA02927 64..296 CDD:222943 53/206 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19325
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.