DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9095 and CR1L

DIOPT Version :9

Sequence 1:NP_001096984.1 Gene:CG9095 / 32447 FlyBaseID:FBgn0030617 Length:1141 Species:Drosophila melanogaster
Sequence 2:NP_783641.1 Gene:CR1L / 1379 HGNCID:2335 Length:569 Species:Homo sapiens


Alignment Length:501 Identity:109/501 - (21%)
Similarity:170/501 - (33%) Gaps:169/501 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 KTCGRPEQPPNSTMVALNGFEVGAQIKYSCDANHLLVGPATRTCLETG---FYNEFPPVCKYIEC 440
            |:|..|..|.|.....:...:..:||||||...:.|:|.::.||:.:|   .::...|||..|.|
Human    94 KSCRNPPDPVNGMAHVIKDIQFRSQIKYSCPKGYRLIGSSSATCIISGNTVIWDNKTPVCDRIIC 158

  Fly   441 GLPASIAHGSYALLNNT-VGYLSLVKYSCEEG------YEMIGRALLTC-DFDER---WNGPPPR 494
            |||.:||:|.:..::.. ..|.|:|.|.|..|      :|::|...:.| ..|::   |:||.|:
Human   159 GLPPTIANGDFTSISREYFHYGSVVTYHCNLGSRGKKVFELVGEPSIYCTSKDDQVGIWSGPAPQ 223

  Fly   495 CEIVECDTLPGNYYSTIINAPNGTYY--GSKAEISCPPGYRMEGPRVLTCLASGQWSSALPRCIK 557
            | |:.....|.|..:.|:.:.|.:.:  ....|..|.||:.|:||..:.|.|..:|...||.|  
Human   224 C-IIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFGMKGPSHVKCQALNKWEPELPSC-- 285

  Fly   558 LEPSTQPTAASTIPVPSSVATPPP--------------FRP------------KVVSST----TS 592
                            |.|..|||              |.|            .:..||    |.
Human   286 ----------------SRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGSTYLHCTP 334

  Fly   593 RTPYRPAVSTASSGIGGSSTSTVGTYPS---LSPTQV--------------EINGESES------ 634
            :..:.||......   .|....:|..|:   |.|..:              ::.|.|.|      
Human   335 QGDWSPAAPRCEV---KSCDDFLGQLPNGHVLFPLNLQLGAKVDFVCDEGFQLKGSSASYCVLAG 396

  Fly   635 -------------EEEINVPPVP--GTVREEFPPRRTVRPVLIPKKPN-------------STPA 671
                         .:....||||  |.|       ..:..:.:..:.|             |...
Human   397 MESLWNSSVPVCERKSCETPPVPVNGMV-------HVITDIHVGSRINYSCTTGHRLIGHSSAEC 454

  Fly   672 ALPPTTHQVPPQPP---STYAPTPPR--SSRPSGAPNSAGEV----------------------- 708
            .|...|.....:||   ..:.|.||.  :.|.:|.|  .|::                       
Human   455 ILSGNTAHWSMKPPICQQIFCPNPPAILNGRHTGTP--LGDIPYGKEVSYTCDPHPDRGMTFNLI 517

  Fly   709 -ETTTRNTQQIIANSHPQDNEIPDSVNIQQNQSPNVNVPFAVDNPD 753
             |:|.|.|      |.|..|      .:..:.:|...:|....:.|
Human   518 GESTIRRT------SEPHGN------GVWSSPAPRCELPVGAGSHD 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9095NP_001096984.1 CCP 37..93 CDD:153056
FTP 94..242 CDD:128870
CLECT 256..375 CDD:214480
Sushi 381..435 CDD:278512 16/56 (29%)
CCP 440..496 CDD:153056 21/66 (32%)
CCP 500..556 CDD:153056 16/57 (28%)
CR1LNP_783641.1 PHA02927 35..287 CDD:222943 60/211 (28%)
Sushi 35..91 CDD:278512
CCP 96..153 CDD:153056 16/56 (29%)
CCP 158..225 CDD:153056 22/67 (33%)
CCP 231..285 CDD:153056 16/53 (30%)
PHA02927 284..541 CDD:222943 48/298 (16%)
CCP 289..346 CDD:153056 10/56 (18%)
CCP 352..409 CDD:153056 7/56 (13%)
CCP 413..471 CDD:153056 12/64 (19%)
CCP 475..542 CDD:153056 15/80 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.