DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and RPL37B

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_010788.1 Gene:RPL37B / 852111 SGDID:S000002908 Length:88 Species:Saccharomyces cerevisiae


Alignment Length:89 Identity:61/89 - (68%)
Similarity:73/89 - (82%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQ 65
            |.|||.||||||||:||||.||||.|:|:||.||:.||||:||.||:||:.|||||.|||||||:
Yeast     1 MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPSAKTRSHNWAAKAKRRHTTGTGRMR 65

  Fly    66 HLKVVRRRFRNGFREGTQAKPKKA 89
            :||.|.|||:|||:.|: ||...|
Yeast    66 YLKHVSRRFKNGFQTGS-AKATSA 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 61/89 (69%)
RPL37BNP_010788.1 PTZ00073 1..83 CDD:240257 58/82 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343877
Domainoid 1 1.000 98 1.000 Domainoid score I1602
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68110
Inparanoid 1 1.050 140 1.000 Inparanoid score I1184
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53564
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - mtm9186
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - LDO PTHR10768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X874
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.