DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and AT1G52300

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_175640.1 Gene:AT1G52300 / 841660 AraportID:AT1G52300 Length:95 Species:Arabidopsis thaliana


Alignment Length:93 Identity:68/93 - (73%)
Similarity:79/93 - (84%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQ 65
            |||||.|||||.||:||||.||||.|:|||||.|:.|.||||:.|:|||||||.||||||||||:
plant     1 MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMR 65

  Fly    66 HLKVVRRRFRNGFREGTQAKPK-KAVAS 92
            :|:.|.|||:.||||||:|||: |.|||
plant    66 YLRNVPRRFKTGFREGTEAKPRNKGVAS 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 65/90 (72%)
AT1G52300NP_175640.1 PTZ00073 1..89 CDD:240257 64/87 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2619
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68110
Inparanoid 1 1.050 144 1.000 Inparanoid score I1761
OMA 1 1.010 - - QHG53564
OrthoDB 1 1.010 - - D1560654at2759
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - mtm1080
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - O PTHR10768
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X874
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.