DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and kcnq3

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_021323522.1 Gene:kcnq3 / 799747 ZFINID:ZDB-GENE-070912-301 Length:795 Species:Danio rerio


Alignment Length:49 Identity:14/49 - (28%)
Similarity:17/49 - (34%) Gaps:12/49 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFR 79
            :|....|| ||..:.    ...:|..|..|...       |.|||..||
Zfish   432 ESVPGNCG-PAEAIE----ESPSKEGKPAGFSN-------RERFRTAFR 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 14/49 (29%)
kcnq3XP_021323522.1 Ion_trans 94..343 CDD:459842
KCNQ_channel 439..637 CDD:460954 12/42 (29%)
KCNQC3-Ank-G_bd 703..791 CDD:463411
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.