| Sequence 1: | NP_573005.1 | Gene: | RpL37-1 / 32446 | FlyBaseID: | FBgn0030616 | Length: | 93 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021323522.1 | Gene: | kcnq3 / 799747 | ZFINID: | ZDB-GENE-070912-301 | Length: | 795 | Species: | Danio rerio |
| Alignment Length: | 49 | Identity: | 14/49 - (28%) |
|---|---|---|---|
| Similarity: | 17/49 - (34%) | Gaps: | 12/49 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 KSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFR 79 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-1 | NP_573005.1 | PTZ00073 | 1..91 | CDD:240257 | 14/49 (29%) |
| kcnq3 | XP_021323522.1 | Ion_trans | 94..343 | CDD:459842 | |
| KCNQ_channel | 439..637 | CDD:460954 | 12/42 (29%) | ||
| KCNQC3-Ank-G_bd | 703..791 | CDD:463411 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||