powered by:
Protein Alignment RpL37a and kcnc4
DIOPT Version :9
Sequence 1: | NP_001259561.1 |
Gene: | RpL37a / 32446 |
FlyBaseID: | FBgn0030616 |
Length: | 93 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001182125.1 |
Gene: | kcnc4 / 799410 |
ZFINID: | ZDB-GENE-060503-773 |
Length: | 603 |
Species: | Danio rerio |
Alignment Length: | 34 |
Identity: | 10/34 - (29%) |
Similarity: | 14/34 - (41%) |
Gaps: | 9/34 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTC 34
|...:.||||..:.: .|:| .|..||
Zfish 479 MVLDSGSFGKSESNS-------PRNS--TQSDTC 503
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2126 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.