DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and kcna1a

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_005163101.1 Gene:kcna1a / 795942 ZFINID:ZDB-GENE-110408-15 Length:492 Species:Danio rerio


Alignment Length:42 Identity:10/42 - (23%)
Similarity:15/42 - (35%) Gaps:9/42 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HTLCRR----CGRSSYHIQKSTCAQ-----CGYPAAKLRSYN 48
            |..|.|    .....:..|..|.||     .|.|..::|.::
Zfish    30 HECCERVVINIAGLRFETQLKTLAQFPETLLGNPKKRMRYFD 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 10/42 (24%)
kcna1aXP_005163101.1 BTB_POZ 34..160 CDD:453885 8/38 (21%)
Ion_trans 163..415 CDD:459842
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.