DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and kcna6a

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001124098.1 Gene:kcna6a / 795490 ZFINID:ZDB-GENE-080722-21 Length:475 Species:Danio rerio


Alignment Length:48 Identity:11/48 - (22%)
Similarity:15/48 - (31%) Gaps:21/48 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FGKRHNK------THTLCRR-----CGRS----------SYHIQKSTC 34
            :.:.||:      ||..|.|     |.|:          |.|.....|
Zfish   407 YHREHNEADQVEYTHVTCGRSLPMQCDRNKSDSKSSLMISEHSNDDAC 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 11/48 (23%)
kcna6aNP_001124098.1 BTB_POZ 31..157 CDD:453885
Ion_trans 203..411 CDD:459842 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.