DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and kcnd2

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001076336.1 Gene:kcnd2 / 570188 ZFINID:ZDB-GENE-041210-70 Length:630 Species:Danio rerio


Alignment Length:92 Identity:20/92 - (21%)
Similarity:33/92 - (35%) Gaps:24/92 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQ 65
            |::.:|.....|..:....||..|.|:::..|..|                 ..||     |.:|
Zfish   514 MSRSSSMSSSPHGLSSCCTRRNKRKSFNVPNSNMA-----------------GGRR-----GSIQ 556

  Fly    66 HLKVVRRRFR--NGFREGTQAKPKKAV 90
            .|..::.|.|  :..|....||.::.|
Zfish   557 ELSTIQIRERPLSNSRSSLNAKFEETV 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 20/92 (22%)
kcnd2NP_001076336.1 BTB_POZ 6..143 CDD:453885
Ion_trans 183..416 CDD:459842
DUF3399 471..547 CDD:463381 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.