DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and kcnv2a

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_695650.4 Gene:kcnv2a / 567267 ZFINID:ZDB-GENE-091117-27 Length:518 Species:Danio rerio


Alignment Length:37 Identity:10/37 - (27%)
Similarity:20/37 - (54%) Gaps:5/37 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AKLRSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGF 78
            :||::|.::...|.|     |:::.:|...:||...|
Zfish   487 SKLKAYEYTSSIKNR-----GKVRFVKRAAKRFAECF 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 10/37 (27%)
kcnv2aXP_695650.4 BTB 84..175 CDD:295341
BTB 86..175 CDD:197585
Ion_trans 285..490 CDD:278921 1/2 (50%)
Ion_trans_2 403..484 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.