DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and Kcnd3

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_064315.1 Gene:Kcnd3 / 56543 MGIID:1928743 Length:655 Species:Mus musculus


Alignment Length:40 Identity:12/40 - (30%)
Similarity:16/40 - (40%) Gaps:5/40 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRS 46
            |.......|.|.|.|..:.:.|:..|     ..||.:|||
Mouse   535 SLSSHSGLTTTCCSRRSKKTTHLPNS-----NLPATRLRS 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 12/40 (30%)
Kcnd3NP_064315.1 BTB_POZ_KCND3 6..143 CDD:349726
Interaction with KCNIP1 and KCNIP2. /evidence=ECO:0000250|UniProtKB:Q9UK17 6..21
Interaction with KCNIP1. /evidence=ECO:0000250|UniProtKB:Q9UK17 70..78
Ion_trans 186..412 CDD:459842
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 367..372
DUF3399 468..563 CDD:463381 7/32 (22%)
Interaction with KCNIP1 and KCNIP2. /evidence=ECO:0000250|UniProtKB:Q9UK17 470..487
Mediates dendritic targeting. /evidence=ECO:0000250|UniProtKB:Q63881 472..487
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 523..565 8/34 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 615..655
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.