| Sequence 1: | NP_573005.1 | Gene: | RpL37-1 / 32446 | FlyBaseID: | FBgn0030616 | Length: | 93 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_064315.1 | Gene: | Kcnd3 / 56543 | MGIID: | 1928743 | Length: | 655 | Species: | Mus musculus |
| Alignment Length: | 40 | Identity: | 12/40 - (30%) |
|---|---|---|---|
| Similarity: | 16/40 - (40%) | Gaps: | 5/40 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 SFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRS 46 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-1 | NP_573005.1 | PTZ00073 | 1..91 | CDD:240257 | 12/40 (30%) |
| Kcnd3 | NP_064315.1 | BTB_POZ_KCND3 | 6..143 | CDD:349726 | |
| Interaction with KCNIP1 and KCNIP2. /evidence=ECO:0000250|UniProtKB:Q9UK17 | 6..21 | ||||
| Interaction with KCNIP1. /evidence=ECO:0000250|UniProtKB:Q9UK17 | 70..78 | ||||
| Ion_trans | 186..412 | CDD:459842 | |||
| Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 | 367..372 | ||||
| DUF3399 | 468..563 | CDD:463381 | 7/32 (22%) | ||
| Interaction with KCNIP1 and KCNIP2. /evidence=ECO:0000250|UniProtKB:Q9UK17 | 470..487 | ||||
| Mediates dendritic targeting. /evidence=ECO:0000250|UniProtKB:Q63881 | 472..487 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 523..565 | 8/34 (24%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 615..655 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||