powered by:
Protein Alignment RpL37a and kcns3a
DIOPT Version :9
Sequence 1: | NP_001259561.1 |
Gene: | RpL37a / 32446 |
FlyBaseID: | FBgn0030616 |
Length: | 93 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001122196.1 |
Gene: | kcns3a / 565375 |
ZFINID: | ZDB-GENE-080723-45 |
Length: | 499 |
Species: | Danio rerio |
Alignment Length: | 44 |
Identity: | 11/44 - (25%) |
Similarity: | 17/44 - (38%) |
Gaps: | 3/44 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 YHIQKSTCAQ--CGYPAAKLRSYNWSVKAKRRKTTGTGRMQHLK 68
||..|....: |.:..::...| |.:|.....|..:.|.|..|
Zfish 83 YHTGKIHLMEELCVFSFSQELEY-WGIKELHLDTCCSNRFQEQK 125
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
RpL37a | NP_001259561.1 |
PTZ00073 |
1..91 |
CDD:240257 |
11/44 (25%) |
kcns3a | NP_001122196.1 |
BTB_2 |
17..116 |
CDD:308049 |
7/33 (21%) |
Ion_trans |
189..426 |
CDD:306908 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2126 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.